Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332902.1	internal	241	3-725(+)
Amino Acid sequence :
LSHLTTKQSPPIKAISTFRRPAPPCMATAVAVSGNQSYWDSIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIHLMHAAAHAHEHLPLTD GSRPDSKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEELR N
Physicochemical properties
Number of amino acids:		241
Molecular weight:		15,819.956
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		104.632
aromaticity		0.014
GRAVY		-1.272
Secondary Structure Fraction
Helix		0.159
turn		0.319
sheet		0.188

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332902.1	3prime_partial	158	475-2(-)
Amino Acid sequence :
MDRASSSNPNGAIPSPVRSSMLGLNLCWISGLESGLEPSVRGRCSWAWAAACMRCMAEAAAMAWLRWPPMSSQAATQRAEAVVAGAERVRWCMGSKTVSGDLIGMAFFRYELMSSWMESQ YDWLPETATAVAMQGGAGRRNVDIALMGGLCLVVRWER
Physicochemical properties
Number of amino acids:		158
Molecular weight:		15,819.956
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		104.632
aromaticity		0.014
GRAVY		-1.272
Secondary Structure Fraction
Helix		0.159
turn		0.319
sheet		0.188

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332902.1	5prime_partial	138	2-418(+)
Amino Acid sequence :
SLPPHHQTKSPHQSNINIPPPSAALHGHRRRRLRQPIILGLHPGRHQLVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPHACGGPRPRAPPPHR RLQARFQARYPTQIQPQH*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		15,819.956
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		104.632
aromaticity		0.014
GRAVY		-1.272
Secondary Structure Fraction
Helix		0.159
turn		0.319
sheet		0.188

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332902.1	internal	241	3-725(+)
Amino Acid sequence :
LSHLTTKQSPPIKAISTFRRPAPPCMATAVAVSGNQSYWDSIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIHLMHAAAHAHEHLPLTD GSRPDSKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAILAGGADEEIEELR N
Physicochemical properties
Number of amino acids:		241
Molecular weight:		15,819.956
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		104.632
aromaticity		0.014
GRAVY		-1.272
Secondary Structure Fraction
Helix		0.159
turn		0.319
sheet		0.188

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332902.1	3prime_partial	158	475-2(-)
Amino Acid sequence :
MDRASSSNPNGAIPSPVRSSMLGLNLCWISGLESGLEPSVRGRCSWAWAAACMRCMAEAAAMAWLRWPPMSSQAATQRAEAVVAGAERVRWCMGSKTVSGDLIGMAFFRYELMSSWMESQ YDWLPETATAVAMQGGAGRRNVDIALMGGLCLVVRWER
Physicochemical properties
Number of amino acids:		158
Molecular weight:		15,819.956
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		104.632
aromaticity		0.014
GRAVY		-1.272
Secondary Structure Fraction
Helix		0.159
turn		0.319
sheet		0.188

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332902.1	5prime_partial	138	2-418(+)
Amino Acid sequence :
SLPPHHQTKSPHQSNINIPPPSAALHGHRRRRLRQPIILGLHPGRHQLVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPHACGGPRPRAPPPHR RLQARFQARYPTQIQPQH*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		15,819.956
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		104.632
aromaticity		0.014
GRAVY		-1.272
Secondary Structure Fraction
Helix		0.159
turn		0.319
sheet		0.188