Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332909.1 | complete | 250 | 70-822(+) |
Amino Acid sequence : | |||
MVKNYPAVSEEYLKAVEKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRP DKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLVEKYAADEDAFFTDYAEAHL KLSELGFADA* | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,682.058 | ||
Theoretical pI: | 5.428 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 34.144 | ||
aromaticity | 0.092 | ||
GRAVY | -0.400 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.232 | ||
sheet | 0.300 |