| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332909.1 | complete | 250 | 70-822(+) |
Amino Acid sequence : | |||
| MVKNYPAVSEEYLKAVEKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRP DKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLVEKYAADEDAFFTDYAEAHL KLSELGFADA* | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 27,682.058 | ||
| Theoretical pI: | 5.428 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 34.144 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.232 | ||
| sheet | 0.300 | ||