| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332918.1 | 3prime_partial | 173 | 36-554(+) |
Amino Acid sequence : | |||
| MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVAEFIPFSSDKLPEIYTKFLVDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,628.736 | ||
| Theoretical pI: | 5.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 41.389 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.220 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332918.1 | 3prime_partial | 173 | 36-554(+) |
Amino Acid sequence : | |||
| MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVAEFIPFSSDKLPEIYTKFLVDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,628.736 | ||
| Theoretical pI: | 5.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 41.389 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.220 | ||
| sheet | 0.202 | ||