| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332924.1 | complete | 213 | 54-695(+) |
Amino Acid sequence : | |||
| MMKASFKARYEPDKAAAAATVSLNAGDFKLRASLTDATIVNGPTLNGLALAVEKPGFFIVDYNVPKKDVRFQFMNTIRVAEKPLNLTYIHSKGEERTILDGALVIDSANKVSANHVLGTA NTKLKYTYVHGGASTFEPSYDLGKNAWDFAVSHKLYQDDVFRATYQTSSKNLGLEWTRSSKQHGSFKIIASVNLAEERKIPKLSAETTWDFEI* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,585.475 | ||
| Theoretical pI: | 9.097 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 12.499 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.221 | ||
| sheet | 0.263 | ||