| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332930.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
| EGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGE ISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPSASTTHESGRGYTRRLHNSKRIQGRGERV | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 11,561.268 | ||
| Theoretical pI: | 5.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.434 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.194 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332930.1 | 3prime_partial | 103 | 309-1(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPF | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,561.268 | ||
| Theoretical pI: | 5.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.434 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.194 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332930.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
| EGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGE ISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPSASTTHESGRGYTRRLHNSKRIQGRGERV | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 11,561.268 | ||
| Theoretical pI: | 5.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.434 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.194 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332930.1 | 3prime_partial | 103 | 309-1(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPF | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,561.268 | ||
| Theoretical pI: | 5.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 50.434 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.015 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.194 | ||
| sheet | 0.291 | ||