| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332941.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| AAKKEDKPNKRRKEDRHSFISKPDEATGPYPEAVLLRERKVEEDGRRMPEFADVDERELFEALNLALESDMDVDQMRHYEVVYLIHEDHKDEVENVNTKVREFLEEKKGKVWRFSDWGMR RLAYKIKKANNAHYILMNFELEAQWINDFKSMLDKDERVIRHLVMKQDKAETGDCPPPPEFHTLRSDMVDDEDLDEEEEDDDEDWG | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 14,535.967 | ||
| Theoretical pI: | 5.199 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.824 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.457 | ||
| turn | 0.181 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332941.1 | complete | 127 | 486-103(-) |
Amino Acid sequence : | |||
| MSDDPLVFVEHAFEIVDPLSFKLEVHENVVGVVRLLYLVRQPAHAPVAESPNLALLLLQEFSNFGVDILNLVLVILMDQIYNFIMPHLINIHITLQRQVQSLKEFTLIDVCKLRHTPTIF LNLPLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,535.967 | ||
| Theoretical pI: | 5.199 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.824 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.457 | ||
| turn | 0.181 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332941.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| AAKKEDKPNKRRKEDRHSFISKPDEATGPYPEAVLLRERKVEEDGRRMPEFADVDERELFEALNLALESDMDVDQMRHYEVVYLIHEDHKDEVENVNTKVREFLEEKKGKVWRFSDWGMR RLAYKIKKANNAHYILMNFELEAQWINDFKSMLDKDERVIRHLVMKQDKAETGDCPPPPEFHTLRSDMVDDEDLDEEEEDDDEDWG | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 14,535.967 | ||
| Theoretical pI: | 5.199 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.824 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.457 | ||
| turn | 0.181 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332941.1 | complete | 127 | 486-103(-) |
Amino Acid sequence : | |||
| MSDDPLVFVEHAFEIVDPLSFKLEVHENVVGVVRLLYLVRQPAHAPVAESPNLALLLLQEFSNFGVDILNLVLVILMDQIYNFIMPHLINIHITLQRQVQSLKEFTLIDVCKLRHTPTIF LNLPLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,535.967 | ||
| Theoretical pI: | 5.199 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 47.824 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.457 | ||
| turn | 0.181 | ||
| sheet | 0.307 | ||