| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332944.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| GPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTID LIKGGFPSGKYLFAGVVDGRNIWANDLASSITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKGEAFFSANAAAXASRKSS | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 24,822.137 | ||
| Theoretical pI: | 5.442 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 23.635 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.227 | ||
| sheet | 0.326 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332944.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| GPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTID LIKGGFPSGKYLFAGVVDGRNIWANDLASSITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKGEAFFSANAAAXASRKSS | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 24,822.137 | ||
| Theoretical pI: | 5.442 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 23.635 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.227 | ||
| sheet | 0.326 | ||