Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332944.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
GPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTID LIKGGFPSGKYLFAGVVDGRNIWANDLASSITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKGEAFFSANAAAXASRKSS | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 24,822.137 | ||
Theoretical pI: | 5.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 23.635 | ||
aromaticity | 0.090 | ||
GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.227 | ||
sheet | 0.326 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332944.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
GPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTID LIKGGFPSGKYLFAGVVDGRNIWANDLASSITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKGEAFFSANAAAXASRKSS | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 24,822.137 | ||
Theoretical pI: | 5.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 23.635 | ||
aromaticity | 0.090 | ||
GRAVY | 0.219 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.227 | ||
sheet | 0.326 |