| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332946.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| STAVLVQQQPLVLKYHNGTLLKGTVTVNLIWYGKFTSVQRSIIVDFLQSLNSPKSPQPSVSTWWKTTEKYKSGGGASTVVLGKQFLDETYSLGKTLTDPQIVNLAALGGHSAGTINVVLT AKEVAVDGFCRSRCGSHGSTRGAERFLYAWVGNSEDLCPGYCAWPFHQPVYGPQSPPLVAPNDDVGADGMVINLATVLAGAATNPFNNGYFQGPASAPMEAVSACTGVFGSGAYPGYAGN VLVDKSISNGSCKTQILGF | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 15,871.312 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.952 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.614 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.171 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332946.1 | 5prime_partial | 140 | 777-355(-) |
Amino Acid sequence : | |||
| KPQNLGFAAPVGDALIHQHIARVPRVRARPKHARTSAHRLHRRTRRPLKVPVIERIRRRSRQHGRQIYHHAVRADVVIRRHERRRLRPVHRLVERPRAVARAQILRVTNPRVQKPLGAAS GAVAAASAPAEAVDGDLLSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,871.312 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.952 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.614 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.171 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332946.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| STAVLVQQQPLVLKYHNGTLLKGTVTVNLIWYGKFTSVQRSIIVDFLQSLNSPKSPQPSVSTWWKTTEKYKSGGGASTVVLGKQFLDETYSLGKTLTDPQIVNLAALGGHSAGTINVVLT AKEVAVDGFCRSRCGSHGSTRGAERFLYAWVGNSEDLCPGYCAWPFHQPVYGPQSPPLVAPNDDVGADGMVINLATVLAGAATNPFNNGYFQGPASAPMEAVSACTGVFGSGAYPGYAGN VLVDKSISNGSCKTQILGF | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 15,871.312 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.952 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.614 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.171 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332946.1 | 5prime_partial | 140 | 777-355(-) |
Amino Acid sequence : | |||
| KPQNLGFAAPVGDALIHQHIARVPRVRARPKHARTSAHRLHRRTRRPLKVPVIERIRRRSRQHGRQIYHHAVRADVVIRRHERRRLRPVHRLVERPRAVARAQILRVTNPRVQKPLGAAS GAVAAASAPAEAVDGDLLSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,871.312 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 68.952 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.614 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.171 | ||
| sheet | 0.250 | ||