| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332948.1 | 3prime_partial | 220 | 81-740(+) |
Amino Acid sequence : | |||
| MADSSKLTVLLTGAGGRTGQIAYKKLKERSDHYITRGLVRTAESKEKIGGSDDVYVADIRNSESIVSAIQGVDALIILTSAVPKMKPGFDPAKGGRPDFYFEEGAYPEQVDWIGQKNQID AAKAAGVKHIVLVGSMGGTNPDHPLNSLANGNILIWKRKAEQYLADSGIPYTIIRAGGLQDREGGLRELLVGKDDELLKTETRTIPRADVAEVCIQALNF | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 23,765.749 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 29.000 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.236 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332948.1 | 3prime_partial | 220 | 81-740(+) |
Amino Acid sequence : | |||
| MADSSKLTVLLTGAGGRTGQIAYKKLKERSDHYITRGLVRTAESKEKIGGSDDVYVADIRNSESIVSAIQGVDALIILTSAVPKMKPGFDPAKGGRPDFYFEEGAYPEQVDWIGQKNQID AAKAAGVKHIVLVGSMGGTNPDHPLNSLANGNILIWKRKAEQYLADSGIPYTIIRAGGLQDREGGLRELLVGKDDELLKTETRTIPRADVAEVCIQALNF | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 23,765.749 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 29.000 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.236 | ||
| sheet | 0.255 | ||