| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332951.1 | internal | 303 | 1-909(+) |
Amino Acid sequence : | |||
| YIVDISXGQIEENGGVEFTGIPEGIPSMAEYLADYCAVTGRPWPASQWKFYIAFSLFRGASIYAGVHSRWIMGNASGGERARFGGKKADAMIETALAFVHRDSVLPAHPPKEIIPREHAQ PLRRESRDSLHVSGGKFGPSRKVENLRNKLIKFMEDHIYPMENEFSKLAQSSMRWSIHPEEERLKELAKKEGLWNLFIPFDSAARVKEVISGQRKDGEIDNNFDILLGAGLSNLEYGYLC EIMGRSVWAPQVFNCGAPDTGNMEVLMRYGDAQQIRQWLVPLLEGKIRSGFAMTEPQVASSDA | |||
Physicochemical properties | |||
| Number of amino acids: | 303 | ||
| Molecular weight: | 13,571.273 | ||
| Theoretical pI: | 9.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 53.561 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.368 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332951.1 | 5prime_partial | 125 | 908-531(-) |
Amino Acid sequence : | |||
| ASEDATCGSVIANPDRIFPSSRGTSHWRICCASPYRIKTSIFPVSGAPQLNTCGAHTERPMISQRYPYSRFDRPAPSNISKLLSISPSFLCPEITSFTLAALSKGINKFHRPSFLASSFN LSSSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,571.273 | ||
| Theoretical pI: | 9.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 53.561 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.368 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332951.1 | internal | 303 | 1-909(+) |
Amino Acid sequence : | |||
| YIVDISXGQIEENGGVEFTGIPEGIPSMAEYLADYCAVTGRPWPASQWKFYIAFSLFRGASIYAGVHSRWIMGNASGGERARFGGKKADAMIETALAFVHRDSVLPAHPPKEIIPREHAQ PLRRESRDSLHVSGGKFGPSRKVENLRNKLIKFMEDHIYPMENEFSKLAQSSMRWSIHPEEERLKELAKKEGLWNLFIPFDSAARVKEVISGQRKDGEIDNNFDILLGAGLSNLEYGYLC EIMGRSVWAPQVFNCGAPDTGNMEVLMRYGDAQQIRQWLVPLLEGKIRSGFAMTEPQVASSDA | |||
Physicochemical properties | |||
| Number of amino acids: | 303 | ||
| Molecular weight: | 13,571.273 | ||
| Theoretical pI: | 9.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 53.561 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.368 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332951.1 | 5prime_partial | 125 | 908-531(-) |
Amino Acid sequence : | |||
| ASEDATCGSVIANPDRIFPSSRGTSHWRICCASPYRIKTSIFPVSGAPQLNTCGAHTERPMISQRYPYSRFDRPAPSNISKLLSISPSFLCPEITSFTLAALSKGINKFHRPSFLASSFN LSSSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,571.273 | ||
| Theoretical pI: | 9.597 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 53.561 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.368 | ||
| sheet | 0.176 | ||