| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332961.1 | 3prime_partial | 270 | 39-848(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTYGGWGAHGGGAF | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 13,195.793 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.970 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332961.1 | 5prime_partial | 118 | 848-492(-) |
Amino Acid sequence : | |||
| ESTSTMSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,195.793 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.970 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332961.1 | 3prime_partial | 270 | 39-848(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTYGGWGAHGGGAF | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 13,195.793 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.970 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332961.1 | 5prime_partial | 118 | 848-492(-) |
Amino Acid sequence : | |||
| ESTSTMSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,195.793 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 44.970 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.237 | ||
| sheet | 0.229 | ||