Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332970.1 | 5prime_partial | 201 | 809-204(-) |
Amino Acid sequence : | |||
DGIRANTPVGDLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMRRSVAMQKGLPILGVFRSFAAVGVDPEIMGIGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLGLDPEK INVNGGAMAIGHPLGATGARCVATLLHEMGRRGKDCRFGVVSMCIGTGMGAAAVFERGDACDELRNTRTVEKHNFLSKDAR* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 13,847.965 | ||
Theoretical pI: | 10.527 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 77.005 | ||
aromaticity | 0.053 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.353 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332970.1 | complete | 133 | 316-717(+) |
Amino Acid sequence : | |||
MHIDTTPNRQSFPRRPISCSKVATQRAPVAPKGCPIAMAPPFTLIFSGSSPSFLRQYTNCEANASFISKRSMSPSSRPADLTAAGIATAGPIPMISGSTPTAAKLLNTPRIGSPFCIATL LLMSSTAPAPSLT* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,847.965 | ||
Theoretical pI: | 10.527 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 77.005 | ||
aromaticity | 0.053 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.353 | ||
sheet | 0.241 |