| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332970.1 | 5prime_partial | 201 | 809-204(-) |
Amino Acid sequence : | |||
| DGIRANTPVGDLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLMRRSVAMQKGLPILGVFRSFAAVGVDPEIMGIGPAVAIPAAVKSAGLELGDIDLFEINEAFASQFVYCRKKLGLDPEK INVNGGAMAIGHPLGATGARCVATLLHEMGRRGKDCRFGVVSMCIGTGMGAAAVFERGDACDELRNTRTVEKHNFLSKDAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 13,847.965 | ||
| Theoretical pI: | 10.527 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 77.005 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.211 | ||
| turn | 0.353 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332970.1 | complete | 133 | 316-717(+) |
Amino Acid sequence : | |||
| MHIDTTPNRQSFPRRPISCSKVATQRAPVAPKGCPIAMAPPFTLIFSGSSPSFLRQYTNCEANASFISKRSMSPSSRPADLTAAGIATAGPIPMISGSTPTAAKLLNTPRIGSPFCIATL LLMSSTAPAPSLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 13,847.965 | ||
| Theoretical pI: | 10.527 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 77.005 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.211 | ||
| turn | 0.353 | ||
| sheet | 0.241 | ||