| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| VQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDN KCIEILKKCKEAIPASTGKVM | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | complete | 125 | 411-34(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| STSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQ VDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | 5prime_partial | 110 | 783-451(-) |
Amino Acid sequence : | |||
| HHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | 5prime_partial | 101 | 782-477(-) |
Amino Acid sequence : | |||
| ITFPVLAGIASLHFFRISMHLLSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| VQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDN KCIEILKKCKEAIPASTGKVM | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | complete | 125 | 411-34(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| STSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQ VDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | 5prime_partial | 110 | 783-451(-) |
Amino Acid sequence : | |||
| HHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332974.1 | 5prime_partial | 101 | 782-477(-) |
Amino Acid sequence : | |||
| ITFPVLAGIASLHFFRISMHLLSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,515.897 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.290 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.386 | ||
| sheet | 0.228 | ||