Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332982.1	5prime_partial	216	3-653(+)
Amino Acid sequence :
YRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMSPGFKAYAKQVRANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNA VFGDSSALAPGGVRIGAPAMTSRGLVEKDFEQIAEFLHRAVTLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFSSSFDMPGFKMSEMKYKD*
Physicochemical properties
Number of amino acids:		216
Molecular weight:		14,658.934
Theoretical pI:		11.604
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		47.211
aromaticity		0.099
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.313
turn		0.328
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332982.1	complete	131	613-218(-)
Amino Acid sequence :
MSNDEENFSTSALSSSISLLLTSPLLKSFKSLPCSFWIFNVRVTALWRNSAICSKSFSTKPRDVMAGAPMRTPPGANALLSPNTAFLLTVMLHRSQSFSTLFPVNPRGRRSHRTKWFSVP PVTRLYPLLIR*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,658.934
Theoretical pI:		11.604
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		47.211
aromaticity		0.099
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.313
turn		0.328
sheet		0.237