Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332988.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
HMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHS TIVLKPRSL* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,493.566 | ||
Theoretical pI: | 8.805 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 53.380 | ||
aromaticity | 0.085 | ||
GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.279 | ||
sheet | 0.279 |