Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333004.1	5prime_partial	222	2-670(+)
Amino Acid sequence :
KFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVL DGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		222
Molecular weight:		12,626.741
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.655
aromaticity		0.023
GRAVY		-0.691
Secondary Structure Fraction
Helix		0.070
turn		0.469
sheet		0.211

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333004.1	5prime_partial	193	739-158(-)
Amino Acid sequence :
KLVFHTINRTCSSRAKKKNENKNLGAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLH RQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		193
Molecular weight:		12,626.741
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.655
aromaticity		0.023
GRAVY		-0.691
Secondary Structure Fraction
Helix		0.070
turn		0.469
sheet		0.211

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333004.1	5prime_partial	128	3-389(+)
Amino Acid sequence :
NSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSW TATICRWR*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		12,626.741
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.655
aromaticity		0.023
GRAVY		-0.691
Secondary Structure Fraction
Helix		0.070
turn		0.469
sheet		0.211

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333004.1	5prime_partial	222	2-670(+)
Amino Acid sequence :
KFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVL DGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		222
Molecular weight:		12,626.741
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.655
aromaticity		0.023
GRAVY		-0.691
Secondary Structure Fraction
Helix		0.070
turn		0.469
sheet		0.211

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333004.1	5prime_partial	193	739-158(-)
Amino Acid sequence :
KLVFHTINRTCSSRAKKKNENKNLGAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLH RQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		193
Molecular weight:		12,626.741
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.655
aromaticity		0.023
GRAVY		-0.691
Secondary Structure Fraction
Helix		0.070
turn		0.469
sheet		0.211

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333004.1	5prime_partial	128	3-389(+)
Amino Acid sequence :
NSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSW TATICRWR*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		12,626.741
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.655
aromaticity		0.023
GRAVY		-0.691
Secondary Structure Fraction
Helix		0.070
turn		0.469
sheet		0.211