Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333006.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
TLILLLRLRSETTRFAIRRDMETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQS PDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP EKYLDEKTIFHSHPSGRFV | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 24,899.349 | ||
Theoretical pI: | 6.622 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 20.919 | ||
aromaticity | 0.026 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.239 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333006.1 | 5prime_partial | 234 | 779-75(-) |
Amino Acid sequence : | |||
DKAARRVRVEDGLLVEVLLGDNGLDHVLLEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTS TDFFRSFGEVAVNTLSNIRALLLNIHQNLAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLVGVALIHRLRCK* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 24,899.349 | ||
Theoretical pI: | 6.622 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 20.919 | ||
aromaticity | 0.026 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.239 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333006.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
TLILLLRLRSETTRFAIRRDMETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQS PDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP EKYLDEKTIFHSHPSGRFV | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 24,899.349 | ||
Theoretical pI: | 6.622 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 20.919 | ||
aromaticity | 0.026 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.239 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333006.1 | 5prime_partial | 234 | 779-75(-) |
Amino Acid sequence : | |||
DKAARRVRVEDGLLVEVLLGDNGLDHVLLEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTS TDFFRSFGEVAVNTLSNIRALLLNIHQNLAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLVGVALIHRLRCK* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 24,899.349 | ||
Theoretical pI: | 6.622 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 20.919 | ||
aromaticity | 0.026 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.239 | ||
sheet | 0.256 |