Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333008.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
CFDKIRVNPGNFADRRAQFEQLEYTDDDYQKELEHIEKVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSFYGDSPRGMVESAFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLAAEM NVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVS LDQLKAPELLYKS | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,908.584 | ||
Theoretical pI: | 5.725 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
Instability index: | 37.385 | ||
aromaticity | 0.091 | ||
GRAVY | -0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.209 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333008.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
CFDKIRVNPGNFADRRAQFEQLEYTDDDYQKELEHIEKVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSFYGDSPRGMVESAFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLAAEM NVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVS LDQLKAPELLYKS | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,908.584 | ||
Theoretical pI: | 5.725 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
Instability index: | 37.385 | ||
aromaticity | 0.091 | ||
GRAVY | -0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.209 | ||
sheet | 0.277 |