Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333014.1	5prime_partial	206	3-623(+)
Amino Acid sequence :
SCMQENCTFAGTFKELRKHVRADHPSAKPREVDPTLQQKWRRMEREREREDVMSTIRTSMPGAVFFGDYVIEGGHYEFDSDEEEGFDINSMGRNEGMEVGIDQNLMSVFLFLQAFGSADN VGSNIGTRRQERDLNSALDRGSLRMHHDNMVNDLDFSDQYSDDNEHENDGNSGTSLVERLRRQGRVLLGRSGRRRRHREEANQGRR*
Physicochemical properties
Number of amino acids:		206
Molecular weight:		23,801.861
Theoretical pI:		5.563
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10095
Instability index:		65.034
aromaticity		0.068
GRAVY		-1.084
Secondary Structure Fraction
Helix		0.209
turn		0.252
sheet		0.243