Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333014.1 | 5prime_partial | 206 | 3-623(+) |
Amino Acid sequence : | |||
SCMQENCTFAGTFKELRKHVRADHPSAKPREVDPTLQQKWRRMEREREREDVMSTIRTSMPGAVFFGDYVIEGGHYEFDSDEEEGFDINSMGRNEGMEVGIDQNLMSVFLFLQAFGSADN VGSNIGTRRQERDLNSALDRGSLRMHHDNMVNDLDFSDQYSDDNEHENDGNSGTSLVERLRRQGRVLLGRSGRRRRHREEANQGRR* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 23,801.861 | ||
Theoretical pI: | 5.563 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 65.034 | ||
aromaticity | 0.068 | ||
GRAVY | -1.084 | ||
Secondary Structure Fraction | |||
Helix | 0.209 | ||
turn | 0.252 | ||
sheet | 0.243 |