| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333018.1 | complete | 242 | 766-38(-) |
Amino Acid sequence : | |||
| MKGKNNNFFPVHACTHPNLFTISHLSDLHIMIHSKFSVISHIYIILQHGVARRLVERNRRLNRVAPCKSEDAGPTDHRQLPLLVHHLIPSQNADRAAVELPRREEEVEVHRDAEDAHVGV RGQPLDPPHRRRPDVGAGREEVVEHVDAAEADGGVVCDVGLPDLEHSGGDVADAEVVDVDAEVHCILFPASADVAEEGLVFFYEGGGDVAEEGLVFFCEGGGVDCSCCGGHEQEEEGGER EN* | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 24,372.360 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 85.406 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.156 | ||
| turn | 0.318 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333018.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
| SLQKMANPPTIPLILSLSTLLLLLVPTTARAVHSPALAEEDQTFFRDISPTLVEEDQTFFRHICAGGKQNAVHLRVYVHDLRIGHVTPTVFEVGKAYVTDDSPVGFGSVHVLDDLLTAGP DIGSAAVGRIQGLTTNADMSVFGIAMNLNFFFTAGKFNGSTISILGRNQVMDQQRELPVVGGTGVFRFARGYAIQTSVSFDQAASYAVLEYNIYVTYNAKFGVDHDMEIAEM* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,372.360 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 85.406 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.156 | ||
| turn | 0.318 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333018.1 | 5prime_partial | 211 | 1-636(+) |
Amino Acid sequence : | |||
| ITSKNGESTHNPPNSLSLHPPPPARAHHSTSSPLPRPRRRRPDLLPRHLPHPRRRRPDLLPPHLRWRETKCSAPPRLRPRPPHRPRHPHCVRGREGLRHRRLPRRLRQRPRARRPPHGRP RHRVGGGGADPRADHERRHERLRHRDEPQLLLHGGEVQRQHDQHFGTESGDGPATGAAGGRWDRRLPICKGLRDSDVGFFRPGGELRRVGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 24,372.360 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 85.406 | ||
| aromaticity | 0.024 | ||
| GRAVY | -1.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.156 | ||
| turn | 0.318 | ||
| sheet | 0.180 | ||