| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333041.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
| NLGLAVIERLNKIQLDCGSKLAYLHITQPRYTAYGQTESGRHGTADEEAQMMRTWRRTYEGTFISSGGFTRQLGIEAVAQGDADLVAYGRLFISNPDLVLRLKLNAPLTKYVRATFYTHD PVVGYTDYPFLKSDGEKPASRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,905.830 | ||
| Theoretical pI: | 8.705 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 32.651 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.211 | ||
| sheet | 0.261 | ||