Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333048.1	complete	148	102-548(+)
Amino Acid sequence :
MASKRILKELKDLQRDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLV PEIAHMYKTDRTKYESTARSWTQKYAMG*
Physicochemical properties
Number of amino acids:		148
Molecular weight:		11,756.553
Theoretical pI:		9.788
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30480 30730
Instability index:		48.375
aromaticity		0.137
GRAVY		-0.060
Secondary Structure Fraction
Helix		0.343
turn		0.255
sheet		0.167

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333048.1	complete	102	560-252(-)
Amino Acid sequence :
MDSASTHGVFLGPAASSGFVFCSVCLVHMSNFWNKRIVGVWISQQRANRQQDLGYSQCWTPLLFQNIKANAPIAIDVRVKYFCPKCNLWRFKRVIGWEMNRN*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,756.553
Theoretical pI:		9.788
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30480 30730
Instability index:		48.375
aromaticity		0.137
GRAVY		-0.060
Secondary Structure Fraction
Helix		0.343
turn		0.255
sheet		0.167