| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333051.1 | 5prime_partial | 174 | 2-526(+) |
Amino Acid sequence : | |||
| DRLRQAILDKFQAAQLQTMSYVEEKVMQKLREKEAEVEDINKKNMELELRMEQLALEANAWQQRAKYSENMINTLKHNLQQVYAQSRDSKEGCGDSEVDDTASCCNGRPVDFHLLGKEGS EMKELMTCKVCRVKEVSMLLLPCKHLCLCKECESKLSMCPLCQSSKYIGMEVYM* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 13,876.435 | ||
| Theoretical pI: | 8.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 50.065 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.282 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333051.1 | complete | 137 | 436-23(-) |
Amino Acid sequence : | |||
| MFTRQQKHRYLLHPTHLTRHQLLHLAALLSEQVEVDGTAIAARGRVVNLAISTPFFAIPALRVNLLQIMLEGVYHVLAVFRPLLPRVCLQGELLHPQLELHVFFVDVFDLCLFLAKLLHD LLFDVGHGLELGCLEFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,876.435 | ||
| Theoretical pI: | 8.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 50.065 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.282 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333051.1 | 5prime_partial | 124 | 599-225(-) |
Amino Acid sequence : | |||
| QEPSLLAHERVSIETSRVLDSHNSITCKPPCLYTWRTDTMGTYSTYFHILYTNTDVYTATKASIPPSPDTPYTSSAPSSRCPPFRAGGSRRDGHCSTRPCRQPRYLHTLLCYPCSARKPA ADYA* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,876.435 | ||
| Theoretical pI: | 8.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 50.065 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.282 | ||
| sheet | 0.169 | ||