Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333051.1 | 5prime_partial | 174 | 2-526(+) |
Amino Acid sequence : | |||
DRLRQAILDKFQAAQLQTMSYVEEKVMQKLREKEAEVEDINKKNMELELRMEQLALEANAWQQRAKYSENMINTLKHNLQQVYAQSRDSKEGCGDSEVDDTASCCNGRPVDFHLLGKEGS EMKELMTCKVCRVKEVSMLLLPCKHLCLCKECESKLSMCPLCQSSKYIGMEVYM* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 13,876.435 | ||
Theoretical pI: | 8.909 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
Instability index: | 50.065 | ||
aromaticity | 0.097 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.282 | ||
sheet | 0.169 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333051.1 | complete | 137 | 436-23(-) |
Amino Acid sequence : | |||
MFTRQQKHRYLLHPTHLTRHQLLHLAALLSEQVEVDGTAIAARGRVVNLAISTPFFAIPALRVNLLQIMLEGVYHVLAVFRPLLPRVCLQGELLHPQLELHVFFVDVFDLCLFLAKLLHD LLFDVGHGLELGCLEFV* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,876.435 | ||
Theoretical pI: | 8.909 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
Instability index: | 50.065 | ||
aromaticity | 0.097 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.282 | ||
sheet | 0.169 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333051.1 | 5prime_partial | 124 | 599-225(-) |
Amino Acid sequence : | |||
QEPSLLAHERVSIETSRVLDSHNSITCKPPCLYTWRTDTMGTYSTYFHILYTNTDVYTATKASIPPSPDTPYTSSAPSSRCPPFRAGGSRRDGHCSTRPCRQPRYLHTLLCYPCSARKPA ADYA* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,876.435 | ||
Theoretical pI: | 8.909 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
Instability index: | 50.065 | ||
aromaticity | 0.097 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.282 | ||
sheet | 0.169 |