| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333086.1 | 5prime_partial | 264 | 2-796(+) |
Amino Acid sequence : | |||
| FGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGD AGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTA AYGHFGRDDPDFTLETVKILKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 28,848.738 | ||
| Theoretical pI: | 9.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 13.963 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.220 | ||
| sheet | 0.201 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333086.1 | 5prime_partial | 264 | 2-796(+) |
Amino Acid sequence : | |||
| FGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGD AGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTA AYGHFGRDDPDFTLETVKILKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 28,848.738 | ||
| Theoretical pI: | 9.041 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 13.963 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.220 | ||
| sheet | 0.201 | ||