Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333088.1	internal	267	3-803(+)
Amino Acid sequence :
EVELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLY LKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMVLHDWSDD KCIEILKKCKEAIPTSTGKVMIVDAII
Physicochemical properties
Number of amino acids:		267
Molecular weight:		11,099.614
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		48.978
aromaticity		0.057
GRAVY		0.087
Secondary Structure Fraction
Helix		0.236
turn		0.368
sheet		0.198

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333088.1	complete	125	416-39(-)
Amino Acid sequence :
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVRNLQLHRRRQRR GGDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		11,099.614
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		48.978
aromaticity		0.057
GRAVY		0.087
Secondary Structure Fraction
Helix		0.236
turn		0.368
sheet		0.198

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333088.1	5prime_partial	106	802-482(-)
Amino Acid sequence :
IIASTIITFPVLVGIASLHFFRISMHLSSLQSCNTMSMTASAFGRLSNMSPPTKSTPLRGGASATTSGRSNAIPRTHGNASTSFPIAIPWRPPTSTTDRTPLNAVG*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		11,099.614
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		48.978
aromaticity		0.057
GRAVY		0.087
Secondary Structure Fraction
Helix		0.236
turn		0.368
sheet		0.198

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333088.1	internal	267	3-803(+)
Amino Acid sequence :
EVELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLY LKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMVLHDWSDD KCIEILKKCKEAIPTSTGKVMIVDAII
Physicochemical properties
Number of amino acids:		267
Molecular weight:		11,099.614
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		48.978
aromaticity		0.057
GRAVY		0.087
Secondary Structure Fraction
Helix		0.236
turn		0.368
sheet		0.198

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333088.1	complete	125	416-39(-)
Amino Acid sequence :
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVRNLQLHRRRQRR GGDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		11,099.614
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		48.978
aromaticity		0.057
GRAVY		0.087
Secondary Structure Fraction
Helix		0.236
turn		0.368
sheet		0.198

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333088.1	5prime_partial	106	802-482(-)
Amino Acid sequence :
IIASTIITFPVLVGIASLHFFRISMHLSSLQSCNTMSMTASAFGRLSNMSPPTKSTPLRGGASATTSGRSNAIPRTHGNASTSFPIAIPWRPPTSTTDRTPLNAVG*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		11,099.614
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		48.978
aromaticity		0.057
GRAVY		0.087
Secondary Structure Fraction
Helix		0.236
turn		0.368
sheet		0.198