| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
| EIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMI AHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAI INEDGEGDEFSGARLSLDMIMLAVMAQGKERTY | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | 5prime_partial | 148 | 820-374(-) |
Amino Acid sequence : | |||
| ISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDS RSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNL | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| GDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
| EIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMI AHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAI INEDGEGDEFSGARLSLDMIMLAVMAQGKERTY | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | 5prime_partial | 148 | 820-374(-) |
Amino Acid sequence : | |||
| ISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDS RSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNL | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333089.1 | 5prime_partial | 99 | 1-300(+) |
Amino Acid sequence : | |||
| GDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,037.327 | ||
| Theoretical pI: | 11.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.943 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.800 | ||
Secondary Structure Fraction | |||
| Helix | 0.222 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||