| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333092.1 | internal | 273 | 3-821(+) |
Amino Acid sequence : | |||
| SERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKSDNLLEGGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPR IALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGRTGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLYNRQIYPPINVLP SLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIG | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 30,494.239 | ||
| Theoretical pI: | 4.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
| Instability index: | 39.875 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.227 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333092.1 | internal | 273 | 3-821(+) |
Amino Acid sequence : | |||
| SERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKSDNLLEGGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPR IALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGRTGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLYNRQIYPPINVLP SLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIG | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 30,494.239 | ||
| Theoretical pI: | 4.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
| Instability index: | 39.875 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.227 | ||
| sheet | 0.282 | ||