Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333098.1 | 5prime_partial | 254 | 1-765(+) |
Amino Acid sequence : | |||
QFNPLAAKAATISLSGFGPGGPFGFDSFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAKVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRP QPLPAKVLVIGILGMAANVPLGIWREHTEKFSPSWFVAVHAAVPFIGMLRKSVLMPKTAMAFTIAASILGQVIGSRAERHRLKTIAARESGLVETSTGLGPKQEVIAGVRDGLCRESVEW SSNRGASSAADVYC* | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 13,462.880 | ||
Theoretical pI: | 11.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 69.559 | ||
aromaticity | 0.095 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.328 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333098.1 | 5prime_partial | 168 | 770-264(-) |
Amino Acid sequence : | |||
PHQQYTSAADEAPRFELHSTLSLQSPSLTPAITSCFGPKPVEVSTSPDSLAAIVFSRCLSALDPITCPRIDAAIVNAMAVFGIKTDFRSMPMNGTAAWTATNHDGENFSVCSLHIPRGTL AAIPKMPMTSTFAGRGCGRRFLAKAVFARALLAATIAGGHRYFMPGGG* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 13,462.880 | ||
Theoretical pI: | 11.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 69.559 | ||
aromaticity | 0.095 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.328 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333098.1 | 5prime_partial | 116 | 771-421(-) |
Amino Acid sequence : | |||
ATSAIHVSRRRGTAIRAPLNALPAKSVPNSGDHFLLRPQTSRSFDKSRFSRSNRLQPMPLRPRPDHLPQNRCSNRERHGRLRHQNGFPEHAYEWHGSVDRDEPRWGEFFGVFPPYS* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,462.880 | ||
Theoretical pI: | 11.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 69.559 | ||
aromaticity | 0.095 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.328 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333098.1 | 5prime_partial | 254 | 1-765(+) |
Amino Acid sequence : | |||
QFNPLAAKAATISLSGFGPGGPFGFDSFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAKVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRP QPLPAKVLVIGILGMAANVPLGIWREHTEKFSPSWFVAVHAAVPFIGMLRKSVLMPKTAMAFTIAASILGQVIGSRAERHRLKTIAARESGLVETSTGLGPKQEVIAGVRDGLCRESVEW SSNRGASSAADVYC* | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 13,462.880 | ||
Theoretical pI: | 11.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 69.559 | ||
aromaticity | 0.095 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.328 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333098.1 | 5prime_partial | 168 | 770-264(-) |
Amino Acid sequence : | |||
PHQQYTSAADEAPRFELHSTLSLQSPSLTPAITSCFGPKPVEVSTSPDSLAAIVFSRCLSALDPITCPRIDAAIVNAMAVFGIKTDFRSMPMNGTAAWTATNHDGENFSVCSLHIPRGTL AAIPKMPMTSTFAGRGCGRRFLAKAVFARALLAATIAGGHRYFMPGGG* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 13,462.880 | ||
Theoretical pI: | 11.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 69.559 | ||
aromaticity | 0.095 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.328 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333098.1 | 5prime_partial | 116 | 771-421(-) |
Amino Acid sequence : | |||
ATSAIHVSRRRGTAIRAPLNALPAKSVPNSGDHFLLRPQTSRSFDKSRFSRSNRLQPMPLRPRPDHLPQNRCSNRERHGRLRHQNGFPEHAYEWHGSVDRDEPRWGEFFGVFPPYS* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,462.880 | ||
Theoretical pI: | 11.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 69.559 | ||
aromaticity | 0.095 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.328 | ||
sheet | 0.181 |