| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333098.1 | 5prime_partial | 254 | 1-765(+) |
Amino Acid sequence : | |||
| QFNPLAAKAATISLSGFGPGGPFGFDSFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAKVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRP QPLPAKVLVIGILGMAANVPLGIWREHTEKFSPSWFVAVHAAVPFIGMLRKSVLMPKTAMAFTIAASILGQVIGSRAERHRLKTIAARESGLVETSTGLGPKQEVIAGVRDGLCRESVEW SSNRGASSAADVYC* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 13,462.880 | ||
| Theoretical pI: | 11.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 69.559 | ||
| aromaticity | 0.095 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.328 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333098.1 | 5prime_partial | 168 | 770-264(-) |
Amino Acid sequence : | |||
| PHQQYTSAADEAPRFELHSTLSLQSPSLTPAITSCFGPKPVEVSTSPDSLAAIVFSRCLSALDPITCPRIDAAIVNAMAVFGIKTDFRSMPMNGTAAWTATNHDGENFSVCSLHIPRGTL AAIPKMPMTSTFAGRGCGRRFLAKAVFARALLAATIAGGHRYFMPGGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 13,462.880 | ||
| Theoretical pI: | 11.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 69.559 | ||
| aromaticity | 0.095 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.328 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333098.1 | 5prime_partial | 116 | 771-421(-) |
Amino Acid sequence : | |||
| ATSAIHVSRRRGTAIRAPLNALPAKSVPNSGDHFLLRPQTSRSFDKSRFSRSNRLQPMPLRPRPDHLPQNRCSNRERHGRLRHQNGFPEHAYEWHGSVDRDEPRWGEFFGVFPPYS* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,462.880 | ||
| Theoretical pI: | 11.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 69.559 | ||
| aromaticity | 0.095 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.328 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333098.1 | 5prime_partial | 254 | 1-765(+) |
Amino Acid sequence : | |||
| QFNPLAAKAATISLSGFGPGGPFGFDSFLEKWKKDSKKPKPSKKESSSKGGQSEHEAMCNEWLQNGNCPIAKSYRAVSGVLPLVAKVLQPPPGIKYRCPPAIVAARSALAKTAFAKNLRP QPLPAKVLVIGILGMAANVPLGIWREHTEKFSPSWFVAVHAAVPFIGMLRKSVLMPKTAMAFTIAASILGQVIGSRAERHRLKTIAARESGLVETSTGLGPKQEVIAGVRDGLCRESVEW SSNRGASSAADVYC* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 13,462.880 | ||
| Theoretical pI: | 11.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 69.559 | ||
| aromaticity | 0.095 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.328 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333098.1 | 5prime_partial | 168 | 770-264(-) |
Amino Acid sequence : | |||
| PHQQYTSAADEAPRFELHSTLSLQSPSLTPAITSCFGPKPVEVSTSPDSLAAIVFSRCLSALDPITCPRIDAAIVNAMAVFGIKTDFRSMPMNGTAAWTATNHDGENFSVCSLHIPRGTL AAIPKMPMTSTFAGRGCGRRFLAKAVFARALLAATIAGGHRYFMPGGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 13,462.880 | ||
| Theoretical pI: | 11.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 69.559 | ||
| aromaticity | 0.095 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.328 | ||
| sheet | 0.181 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333098.1 | 5prime_partial | 116 | 771-421(-) |
Amino Acid sequence : | |||
| ATSAIHVSRRRGTAIRAPLNALPAKSVPNSGDHFLLRPQTSRSFDKSRFSRSNRLQPMPLRPRPDHLPQNRCSNRERHGRLRHQNGFPEHAYEWHGSVDRDEPRWGEFFGVFPPYS* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,462.880 | ||
| Theoretical pI: | 11.474 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 69.559 | ||
| aromaticity | 0.095 | ||
| GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.328 | ||
| sheet | 0.181 | ||