Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333106.1 | 5prime_partial | 250 | 3-755(+) |
Amino Acid sequence : | |||
CYSSKHGAFPLCNGEDVQSYYKPLAPCISGTSSKRWIPIRNRSLGSLSNEDLAIHGISPEDFSEELNFWKSALRNYWSLLSPLIFSDHPKRPGDEDPVPPYNMVRNVMDMNAHYGGLATA ILEARKSAWVMNVVPVGQRNTLPIIMDQGFAGVLHNWCEPFPTYPRTYDMLHAKGLLSQIASERCSMLDLIFEMDRILRPEGWVIISDKLSHVEIARTLVTQLRWEARVIDLXDGSEQRL LVCQKPFLRK* | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 28,359.315 | ||
Theoretical pI: | 6.720 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50795 | ||
Instability index: | 49.559 | ||
aromaticity | 0.092 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.261 | ||
sheet | 0.253 |