| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333107.1 | 5prime_partial | 112 | 402-64(-) |
Amino Acid sequence : | |||
| ARGVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,476.193 | ||
| Theoretical pI: | 4.893 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 21.545 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.179 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333107.1 | 5prime_partial | 112 | 402-64(-) |
Amino Acid sequence : | |||
| ARGVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,476.193 | ||
| Theoretical pI: | 4.893 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 21.545 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.179 | ||
| sheet | 0.259 | ||