| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333108.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| VPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,191.878 | ||
| Theoretical pI: | 4.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 22.641 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.174 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333108.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| VPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,191.878 | ||
| Theoretical pI: | 4.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 22.641 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.174 | ||
| sheet | 0.257 | ||