| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333116.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
| NLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQ SMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCY | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 25,537.952 | ||
| Theoretical pI: | 5.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
| Instability index: | 42.109 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.316 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.193 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333116.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
| NLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQ SMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCY | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 25,537.952 | ||
| Theoretical pI: | 5.805 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
| Instability index: | 42.109 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.316 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.193 | ||
| sheet | 0.242 | ||