| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333124.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
| KIEAMDLVDAALAAAIFLLSAALLRHVLTGNRRRTSSPPGPFPLPIIGNLHLLGPRLHHSFHDLTRRYGPLVQLRLGSARCVVAATPELAKEFLKTNELVFSARKHSTAIDIVTQIFGEF DVANIIWFCKNFDFQGIRKRSEDIRRRYDALLEKIITDREKQRRNRGGGGGVAKDFLDVFLDVMESEKAEVQFTREHLKALILVKLPFSFTHFQQYFLRRSPIRQPISFRRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 12,752.387 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 116.300 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.145 | ||
| turn | 0.336 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333124.1 | complete | 162 | 637-149(-) |
Amino Acid sequence : | |||
| MSKRKRQFYQNQSLEMLPGELDFRFLTLHYIQKHVKKILRHAAAAAAVPPLFLPVSDDLLEQSIVPPPYILRPLPYPLKIEVLAKPNNVGDVELAEYLRHDINGGGVFPRREDELVRLQE FLRQLRRGGDDAPGGAEAELHQWTVPSGQIVEAVVEPGPEKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,752.387 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 116.300 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.145 | ||
| turn | 0.336 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333124.1 | 3prime_partial | 125 | 375-1(-) |
Amino Acid sequence : | |||
| MLATSNSPNICVTISMAVECFRAEKTSSFVFRNSFASSGVAATTHRAEPRRSCTSGPYRRVKSWKLWWSLGPRRCKLPMMGRGNGPGGEEVRRRFPVRTWRRRAAERRKMAAASAASTRS MASIF | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,752.387 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 116.300 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.145 | ||
| turn | 0.336 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333124.1 | 5prime_partial | 110 | 1-333(+) |
Amino Acid sequence : | |||
| ENRSHGPRRRRTRRRHLPPLRRPPPPRPNRKSPPYFLPSRPIPSSHHRQFTPSRAQAPPQLPRFDPTVRSTGAAPPRLRPVRRRRHAGAGEGIPEDERARLLGAETLHRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,752.387 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 116.300 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.145 | ||
| turn | 0.336 | ||
| sheet | 0.191 | ||