| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | internal | 283 | 1-849(+) |
Amino Acid sequence : | |||
| EAQLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSD DKCIEILKKCKEAIPANIGKVMIVDAIINEDGEGDEFSGTRLS | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | 5prime_partial | 131 | 849-454(-) |
Amino Acid sequence : | |||
| RQTSTRKLIPFSIFVNYSIYNHHFADIRWNRFFTFLQNFYAFIVAPIMQYPHEHDCVSFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQFPNSRSVTAAHIHHRLHSVKR RRIVSYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
| SPTSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLS EVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | complete | 125 | 414-37(-) |
Amino Acid sequence : | |||
| MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | 5prime_partial | 105 | 848-531(-) |
Amino Acid sequence : | |||
| DKRVPENSSPSPSSLIIASTIITLPIFAGIASLHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSFPIAVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | internal | 283 | 1-849(+) |
Amino Acid sequence : | |||
| EAQLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSD DKCIEILKKCKEAIPANIGKVMIVDAIINEDGEGDEFSGTRLS | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | 5prime_partial | 131 | 849-454(-) |
Amino Acid sequence : | |||
| RQTSTRKLIPFSIFVNYSIYNHHFADIRWNRFFTFLQNFYAFIVAPIMQYPHEHDCVSFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQFPNSRSVTAAHIHHRLHSVKR RRIVSYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
| SPTSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLS EVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | complete | 125 | 414-37(-) |
Amino Acid sequence : | |||
| MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333128.1 | 5prime_partial | 105 | 848-531(-) |
Amino Acid sequence : | |||
| DKRVPENSSPSPSSLIIASTIITLPIFAGIASLHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSFPIAVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,908.381 | ||
| Theoretical pI: | 11.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.242 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.400 | ||
| sheet | 0.210 | ||