Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333155.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
TMSFMKGDLLTKTRKLVKSMVKTEPVWLKSMEKAPPATFPRAQNKLRQITFPEDAYVSKFYQKFPDSKFEDPIKISGFDPPEARSYAWRVLELKEQGVEEGDAIAVADSEYRAQRIARKK AYARLKQIAKLQGKRPPPNPFPSAIKEIQAEERKFVSERFYNPRSRDILERLHREKAAIMMDRR* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 21,492.659 | ||
Theoretical pI: | 9.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 61.002 | ||
aromaticity | 0.098 | ||
GRAVY | -0.807 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.185 | ||
sheet | 0.277 |