| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333155.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
| TMSFMKGDLLTKTRKLVKSMVKTEPVWLKSMEKAPPATFPRAQNKLRQITFPEDAYVSKFYQKFPDSKFEDPIKISGFDPPEARSYAWRVLELKEQGVEEGDAIAVADSEYRAQRIARKK AYARLKQIAKLQGKRPPPNPFPSAIKEIQAEERKFVSERFYNPRSRDILERLHREKAAIMMDRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 21,492.659 | ||
| Theoretical pI: | 9.957 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 61.002 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.807 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.185 | ||
| sheet | 0.277 | ||