Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333160.1 | complete | 161 | 112-597(+) |
Amino Acid sequence : | |||
MESTKETGCQAPEGPILCINNCGFFGSAATMNMCSKCHKDMVLKQQQAKLAAASIENMVSGSNLKEAIPAGPIEIKIECPTRVPDVGASVSEPKRKEGPNRCSSCRKRVGLTGFSCRCGN LFCSVHRYSDKHECPFDYRSAGQDAIAKANPVVKADKLEKI* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 11,924.721 | ||
Theoretical pI: | 11.910 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 36.716 | ||
aromaticity | 0.077 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.212 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333160.1 | complete | 104 | 696-382(-) |
Amino Acid sequence : | |||
MMQLNHNHPSFLSPTPTHPTQVHTPTTIILQHTSYLLQLVSFHNRIRLRYRVLTSRPVIKRAFVFVRVTMNRAEQVPTPTTEAGQPHTLAATTASIWSLLSFRL* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,924.721 | ||
Theoretical pI: | 11.910 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 36.716 | ||
aromaticity | 0.077 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.212 | ||
sheet | 0.221 |