| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333161.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
| SLGSGHVGRARYEWQSACSILASKVESQQRDTEKSADGVSVVNGHPTLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQ AVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGL QIL | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 16,601.089 | ||
| Theoretical pI: | 11.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 59.971 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.492 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.140 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333161.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
| MNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTGGGFTVRAGDALVSDAQLRAVHRRRGEVGDAERLRERRRRWRVRLLFDWDYVKRRVTVDDGDAIGALLGVPLLRLHL ASEYRARALPFVTRPAYVTGAEA | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,601.089 | ||
| Theoretical pI: | 11.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 59.971 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.492 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.140 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333161.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
| SLGSGHVGRARYEWQSACSILASKVESQQRDTEKSADGVSVVNGHPTLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQ AVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGL QIL | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 16,601.089 | ||
| Theoretical pI: | 11.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 59.971 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.492 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.140 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333161.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
| MNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTGGGFTVRAGDALVSDAQLRAVHRRRGEVGDAERLRERRRRWRVRLLFDWDYVKRRVTVDDGDAIGALLGVPLLRLHL ASEYRARALPFVTRPAYVTGAEA | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,601.089 | ||
| Theoretical pI: | 11.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 59.971 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.492 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.140 | ||
| sheet | 0.287 | ||