| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333170.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
| AWTLILYSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKD KAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNG KLTGMAFRVPTVD | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 15,535.332 | ||
| Theoretical pI: | 6.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
| Instability index: | 63.442 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.312 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333170.1 | 5prime_partial | 141 | 760-335(-) |
Amino Acid sequence : | |||
| INCWDTEGHPSQLSIQSRENFANSLCSSGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLFINTDDKHGCILTRSRND DLLCTTLQMSRSLILVGENSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,535.332 | ||
| Theoretical pI: | 6.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
| Instability index: | 63.442 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.312 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333170.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
| AWTLILYSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKD KAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNG KLTGMAFRVPTVD | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 15,535.332 | ||
| Theoretical pI: | 6.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
| Instability index: | 63.442 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.312 | ||
| sheet | 0.156 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333170.1 | 5prime_partial | 141 | 760-335(-) |
Amino Acid sequence : | |||
| INCWDTEGHPSQLSIQSRENFANSLCSSGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLFINTDDKHGCILTRSRND DLLCTTLQMSRSLILVGENSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,535.332 | ||
| Theoretical pI: | 6.439 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
| Instability index: | 63.442 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.312 | ||
| sheet | 0.156 | ||