| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333180.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| TSTPNQFLPASRFSKLPSLTFPSSQNLSQTHFRKSKSVPGLLVVASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVAAGTGNGKRAKEFMEKGQLVPDEIVVMMV KERLSQQDSLENGWLLDGYPRSESQATALKKLGFDPDIFILLEVPEDILVERVVGRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLVTHNSNVEAVLSLYEDLICKVDG TLPKEEVFTQINTTLSELLTKKK | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 29,091.116 | ||
| Theoretical pI: | 6.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 41.754 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.221 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333180.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| TSTPNQFLPASRFSKLPSLTFPSSQNLSQTHFRKSKSVPGLLVVASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVAAGTGNGKRAKEFMEKGQLVPDEIVVMMV KERLSQQDSLENGWLLDGYPRSESQATALKKLGFDPDIFILLEVPEDILVERVVGRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLVTHNSNVEAVLSLYEDLICKVDG TLPKEEVFTQINTTLSELLTKKK | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 29,091.116 | ||
| Theoretical pI: | 6.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 41.754 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.221 | ||
| sheet | 0.289 | ||