| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333186.1 | 5prime_partial | 241 | 1-726(+) |
Amino Acid sequence : | |||
| KTPSRESLYKKAAGKSSTLPTKKPGDQGDKDQNRNAADSQDSENSKLSEKDREELMALRDQVEDLKRQLSEKDDLLEATEVSKKEMASVQTKYDELQSEAAEKDSLIKSTQLQLSDAKVK LADKQAAVEKLQWEATTSKENVQRLQEDLDKVQEEISSFMLLIDGLTRNDFVISNGDYDDVPYSIDQNHEIDDEMDMQALEAAREAYMTAVAAAKEKQDEESISAAARARSHLQSLVLQQ F* | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,092.562 | ||
| Theoretical pI: | 4.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 51.498 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.946 | ||
Secondary Structure Fraction | |||
| Helix | 0.212 | ||
| turn | 0.166 | ||
| sheet | 0.340 | ||