Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333186.1 | 5prime_partial | 241 | 1-726(+) |
Amino Acid sequence : | |||
KTPSRESLYKKAAGKSSTLPTKKPGDQGDKDQNRNAADSQDSENSKLSEKDREELMALRDQVEDLKRQLSEKDDLLEATEVSKKEMASVQTKYDELQSEAAEKDSLIKSTQLQLSDAKVK LADKQAAVEKLQWEATTSKENVQRLQEDLDKVQEEISSFMLLIDGLTRNDFVISNGDYDDVPYSIDQNHEIDDEMDMQALEAAREAYMTAVAAAKEKQDEESISAAARARSHLQSLVLQQ F* | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,092.562 | ||
Theoretical pI: | 4.620 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 51.498 | ||
aromaticity | 0.037 | ||
GRAVY | -0.946 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.166 | ||
sheet | 0.340 |