| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333214.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
| LSLSLAMDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGNRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE TLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYVKFHWKPTCGVKS LLEDEAXQVGGANHSHATQDLYDSIAAGNYP | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 30,525.023 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 26.230 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.274 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333214.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
| LSLSLAMDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGNRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPE TLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYVKFHWKPTCGVKS LLEDEAXQVGGANHSHATQDLYDSIAAGNYP | |||
Physicochemical properties | |||
| Number of amino acids: | 271 | ||
| Molecular weight: | 30,525.023 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 26.230 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.274 | ||
| sheet | 0.207 | ||