Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333217.1 | complete | 181 | 137-682(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 17,883.963 | ||
Theoretical pI: | 5.533 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 42.272 | ||
aromaticity | 0.068 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.193 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333217.1 | 5prime_partial | 161 | 773-288(-) |
Amino Acid sequence : | |||
VDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVC HRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 17,883.963 | ||
Theoretical pI: | 5.533 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 42.272 | ||
aromaticity | 0.068 | ||
GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.193 | ||
sheet | 0.236 |