| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333217.1 | complete | 181 | 137-682(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 17,883.963 | ||
| Theoretical pI: | 5.533 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 42.272 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.193 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333217.1 | 5prime_partial | 161 | 773-288(-) |
Amino Acid sequence : | |||
| VDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVC HRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 17,883.963 | ||
| Theoretical pI: | 5.533 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 42.272 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.476 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.193 | ||
| sheet | 0.236 | ||