Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333242.1 | internal | 162 | 487-2(-) |
Amino Acid sequence : | |||
GAFDCADIIARVRDIKPVWALANDMNCSAGQLLASAASRRLVTQTARTGSIGVMMAHSNYGAALEKQGVEITLIYSGSHKVDGNPYSHLPDDVRETLQSRMDATRQMFAQKVSAYTGLSV QVVLDTEAAVYSGQEAIDAGLADELVNSTDAITVMRDALDAR | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,255.747 | ||
Theoretical pI: | 8.968 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
Instability index: | 35.309 | ||
aromaticity | 0.037 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.216 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333242.1 | internal | 162 | 2-487(+) |
Amino Acid sequence : | |||
TCIQCITHDGDRIGAVNKFISQSGINGLLTAVHCSLGIQHNLHGQAGICRHLLRKHLAGCVHPGLQCLPDVIRKMAVGVAIHLMAAAVNQRDFHTLFLQRSTVITVSHHDADGACPGGLR DQTPGGGTGKQLTCTAVHVVGKRPYRFYVTHTGDDVSAVKCP | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,255.747 | ||
Theoretical pI: | 8.968 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
Instability index: | 35.309 | ||
aromaticity | 0.037 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.216 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333242.1 | internal | 162 | 487-2(-) |
Amino Acid sequence : | |||
GAFDCADIIARVRDIKPVWALANDMNCSAGQLLASAASRRLVTQTARTGSIGVMMAHSNYGAALEKQGVEITLIYSGSHKVDGNPYSHLPDDVRETLQSRMDATRQMFAQKVSAYTGLSV QVVLDTEAAVYSGQEAIDAGLADELVNSTDAITVMRDALDAR | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,255.747 | ||
Theoretical pI: | 8.968 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
Instability index: | 35.309 | ||
aromaticity | 0.037 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.216 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333242.1 | internal | 162 | 2-487(+) |
Amino Acid sequence : | |||
TCIQCITHDGDRIGAVNKFISQSGINGLLTAVHCSLGIQHNLHGQAGICRHLLRKHLAGCVHPGLQCLPDVIRKMAVGVAIHLMAAAVNQRDFHTLFLQRSTVITVSHHDADGACPGGLR DQTPGGGTGKQLTCTAVHVVGKRPYRFYVTHTGDDVSAVKCP | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,255.747 | ||
Theoretical pI: | 8.968 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
Instability index: | 35.309 | ||
aromaticity | 0.037 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.216 | ||
sheet | 0.179 |