| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333251.1 | internal | 269 | 1-807(+) |
Amino Acid sequence : | |||
| GFFTIFRPLILSSHAFSVDWGFLHCRFIASSHRFCSRRRVFCFQLSWGFRIIPMSKVVDFSGGDDFCPRGFLFQNPKESSPFLSLGSHVDVYFPPRKRSRISAPFIVRANPKVAPLIEIL PDECLFEIFRRLPSQERSVCASVSKRWLMLLSSICAGEICIPTSQYSEPEIAPDCKKADESAKPKEKLESVDDVDGVNSDDEERVDANPQGYLSRCLEGKKATDVRLAAISVGTAGHGGL GKLSIRGNTSTRKLTNLGPKAISRGCPSL | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 11,127.467 | ||
| Theoretical pI: | 10.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 36.682 | ||
| aromaticity | 0.118 | ||
| GRAVY | 1.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.225 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333251.1 | complete | 102 | 41-349(+) |
Amino Acid sequence : | |||
| MHSALIGAFFIAVSLLHLIVFALVGGFSVSSFLGVFASFPCLKSLISVVVMISALEGFCSKIPRNQAPFCLLGAMSTFIFLRARDLVSVLPLLFVRIRRLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,127.467 | ||
| Theoretical pI: | 10.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 36.682 | ||
| aromaticity | 0.118 | ||
| GRAVY | 1.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.225 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333251.1 | internal | 269 | 1-807(+) |
Amino Acid sequence : | |||
| GFFTIFRPLILSSHAFSVDWGFLHCRFIASSHRFCSRRRVFCFQLSWGFRIIPMSKVVDFSGGDDFCPRGFLFQNPKESSPFLSLGSHVDVYFPPRKRSRISAPFIVRANPKVAPLIEIL PDECLFEIFRRLPSQERSVCASVSKRWLMLLSSICAGEICIPTSQYSEPEIAPDCKKADESAKPKEKLESVDDVDGVNSDDEERVDANPQGYLSRCLEGKKATDVRLAAISVGTAGHGGL GKLSIRGNTSTRKLTNLGPKAISRGCPSL | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 11,127.467 | ||
| Theoretical pI: | 10.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 36.682 | ||
| aromaticity | 0.118 | ||
| GRAVY | 1.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.225 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333251.1 | complete | 102 | 41-349(+) |
Amino Acid sequence : | |||
| MHSALIGAFFIAVSLLHLIVFALVGGFSVSSFLGVFASFPCLKSLISVVVMISALEGFCSKIPRNQAPFCLLGAMSTFIFLRARDLVSVLPLLFVRIRRLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,127.467 | ||
| Theoretical pI: | 10.775 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 36.682 | ||
| aromaticity | 0.118 | ||
| GRAVY | 1.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.225 | ||
| sheet | 0.304 | ||