| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333252.1 | complete | 142 | 1-429(+) |
Amino Acid sequence : | |||
| MLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPCEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMIGHLLHHFNWAPPSGVSSDELDMGENPGLVTYMRT PLEAVPTPRLPSDLYKRIAVDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,822.971 | ||
| Theoretical pI: | 6.579 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 32.951 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.296 | ||
| sheet | 0.239 | ||