Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333252.1 | complete | 142 | 1-429(+) |
Amino Acid sequence : | |||
MLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPCEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMIGHLLHHFNWAPPSGVSSDELDMGENPGLVTYMRT PLEAVPTPRLPSDLYKRIAVDL* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,822.971 | ||
Theoretical pI: | 6.579 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 32.951 | ||
aromaticity | 0.077 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.296 | ||
sheet | 0.239 |