| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333267.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKNIF HLNPSGRFVIGGPHEDAG | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,296.593 | ||
| Theoretical pI: | 5.081 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 37.125 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.217 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333267.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKNIF HLNPSGRFVIGGPHEDAG | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,296.593 | ||
| Theoretical pI: | 5.081 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 37.125 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.217 | ||
| sheet | 0.213 | ||