| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333274.1 | 5prime_partial | 182 | 3-551(+) |
Amino Acid sequence : | |||
| KAQIEIDTVVGVDKLLQESDGPNLPYLNAVIKETFRLHPPIPMLSRKSISDCVIGGYTIPADTLLFINIWSMGRNPNIWENPTEFRPERFLEKENATIDIKGQDFELLPFGTGRRGCPGM LLAIQEVTSVIGTMIQCFDWKLPAGDSSGRVDMTERPGLTAPRAEDLVCCVVPRVDALVVSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 17,269.763 | ||
| Theoretical pI: | 11.836 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 65.585 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.791 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.272 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333274.1 | complete | 151 | 590-135(-) |
Amino Acid sequence : | |||
| MYNKTSKFKLFILLTRNNQSINSRHHTTNQILRPRRREPRPLRHVDAAGTVAGGQLPVKALNHGPNHTCHLLNGQQHPRAAPPARPKRKKLEILPFNINGGVLLLQKSLRPELRRIFPNV RVPPHRPNVDEQQRVCRNRVAADHAVGDRFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 17,269.763 | ||
| Theoretical pI: | 11.836 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 65.585 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.791 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.272 | ||
| sheet | 0.205 | ||