Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333276.1 | internal | 254 | 3-764(+) |
Amino Acid sequence : | |||
QRAFAGILQSVDELRYACENWQPLMSKVYFVLQVESLMSKIRNHGLDILELLKSSDECLPVELTPASLEQYVQKMKHVGSEQTSSIITNTIKDHVEGSAASAESLALVADSLGLKSNEEL LIEVVALEKLKENAEQADKSSEVDYIDQMMALVTHMHDLLVMVKQSETCNPVAIPPDFCCPLSLELMTDPVIVASGQTYERAYIRRWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIANW CESNNVKLPDPTKS | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,304.254 | ||
Theoretical pI: | 4.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
Instability index: | 44.848 | ||
aromaticity | 0.051 | ||
GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.205 | ||
sheet | 0.315 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333276.1 | internal | 254 | 3-764(+) |
Amino Acid sequence : | |||
QRAFAGILQSVDELRYACENWQPLMSKVYFVLQVESLMSKIRNHGLDILELLKSSDECLPVELTPASLEQYVQKMKHVGSEQTSSIITNTIKDHVEGSAASAESLALVADSLGLKSNEEL LIEVVALEKLKENAEQADKSSEVDYIDQMMALVTHMHDLLVMVKQSETCNPVAIPPDFCCPLSLELMTDPVIVASGQTYERAYIRRWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIANW CESNNVKLPDPTKS | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,304.254 | ||
Theoretical pI: | 4.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
Instability index: | 44.848 | ||
aromaticity | 0.051 | ||
GRAVY | -0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.205 | ||
sheet | 0.315 |