Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333278.1	complete	254	77-841(+)
Amino Acid sequence :
MEEALRSLNTASTGGSIKPVAAVTKRCSAAKRSHKDGAPAPTGSGNMRYRGVRRRPWGRYAAEIRDPQTKERRWLGTFDTAEEAACAYDCAARAMRGVKARTNFVYPASPSQPPAAAAEN LPPPFGYGKLMSSAPQSILSSRQFLSPSPFSSPNLDFNRSNSINSHRFLLRDYISSSTSKYFDTTNTNTNYNSFGLSSDFLRNSSSSSSLSTITSPNFLGSLSDANTLTVHVSGAASLSP EVRISKTRFPHFIE*
Physicochemical properties
Number of amino acids:		254
Molecular weight:		27,578.392
Theoretical pI:		10.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 23045
Instability index:		67.927
aromaticity		0.091
GRAVY		-0.534
Secondary Structure Fraction
Helix		0.220
turn		0.350
sheet		0.224