| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333279.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
| QLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYSGWKAAAIGANNQAAQSMLKQDYKDEITREEAVQLALKVLSKTMDSTSLTSEKLELAEVLLHNGKVKYQVCS PEALNQLLLKSGVTQPAAETS* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,447.299 | ||
| Theoretical pI: | 5.821 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 37.765 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.241 | ||
| sheet | 0.298 | ||