Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333279.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
QLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYSGWKAAAIGANNQAAQSMLKQDYKDEITREEAVQLALKVLSKTMDSTSLTSEKLELAEVLLHNGKVKYQVCS PEALNQLLLKSGVTQPAAETS* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,447.299 | ||
Theoretical pI: | 5.821 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 37.765 | ||
aromaticity | 0.092 | ||
GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.241 | ||
sheet | 0.298 |